Slc26a9 anticorps (Middle Region)

N° du produit ABIN634992

Cet anticorps anti-Slc26a9 est un anticorps Lapin Polyclonal détectant Slc26a9 dans WB. Adapté pour Humain.

Aperçu rapide pour Slc26a9 anticorps (Middle Region) (ABIN634992)

Antigène: Slc26a9 (Solute Carrier Family 26, Member 9 (Slc26a9))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Slc26a9 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Slc26a9 anticorps

Épitope: Middle Region

Specificité: SLC26 A9 antibody was raised against the middle region of SLC26 9

Purification: Affinity purified

Immunogène: SLC26 A9 antibody was raised using the middle region of SLC26 9 corresponding to a region with amino acids LAKLSSTYGKIGVKVFLVNIHAQVYNDISHGGVFEDGSLECKHVFPSIHD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC26A9 Blocking Peptide, (ABIN940167), is also available for use as a blocking control in assays to test for specificity of this SLC26A9 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Slc26a9

Antigène: Slc26a9 (Solute Carrier Family 26, Member 9 (Slc26a9))

Autre désignation: SLC26A9

Sujet: This gene is one member of a family of sulfate/anion transporter genes. Family members are well conserved in their genomic (number and size of exons) and protein (aa length among species) structures yet have markedly different tissue expression patterns.

Poids moléculaire: 87 kDa (MW of target protein)