CEACAM16 anticorps (Middle Region)

N° du produit ABIN635003

L’anticorps Lapin Polyclonal anti-CEACAM16 a été validé pour WB. Il convient pour détecter CEACAM16 dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour CEACAM16 anticorps (Middle Region) (ABIN635003)

Antigène: CEACAM16 (Carcinoembryonic Antigen-Related Cell Adhesion Molecule 16 (CEACAM16))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CEACAM16 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CEACAM16 anticorps

Épitope: Middle Region

Specificité: CEACAM16 antibody was raised against the middle region of CEACAM16

Purification: Affinity purified

Immunogène: CEACAM16 antibody was raised using the middle region of CEACAM16 corresponding to a region with amino acids TVQGYPKDLLVYAWYRGPASEPNRLLSQLPSGTWIAGPAHTGREVGFPNC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CEACAM16 Blocking Peptide, (ABIN5612810), is also available for use as a blocking control in assays to test for specificity of this CEACAM16 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CEACAM16 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CEACAM16

Antigène: CEACAM16 (Carcinoembryonic Antigen-Related Cell Adhesion Molecule 16 (CEACAM16))

Autre désignation: CEACAM16

Sujet: CEACAM16 is a single-pass type I membrane protein.It belongs to the immunoglobulin superfamily, CEA family.It contains 2 Ig-like C2-type (immunoglobulin-like) domains. The exact function of CEACAM16 remains unknown.

Poids moléculaire: 53 kDa (MW of target protein)

Pathways: Sensory Perception of Sound