C14orf180 anticorps (N-Term)

N° du produit ABIN635016

Cet anticorps anti-C14orf180 est un anticorps Lapin Polyclonal détectant C14orf180 dans WB. Adapté pour Humain.

Aperçu rapide pour C14orf180 anticorps (N-Term) (ABIN635016)

Antigène: C14orf180 (Chromosome 14 Open Reading Frame 180 (C14orf180))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C14orf180 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-C14orf180 anticorps

Épitope: N-Term

Specificité: C14 ORF180 antibody was raised against the N terminal Of C14 rf180

Purification: Affinity purified

Immunogène: C14 ORF180 antibody was raised using the N terminal Of C14 rf180 corresponding to a region with amino acids EDNRKCPPSILKRSRPEHHRPEAKPQRTSRRVWFREPPAVTVHYIADKNA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C14ORF180 Blocking Peptide, (ABIN937707), is also available for use as a blocking control in assays to test for specificity of this C14ORF180 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF180 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C14orf180

Antigène: C14orf180 (Chromosome 14 Open Reading Frame 180 (C14orf180))

Autre désignation: C14ORF180

Sujet: C14orf180 is a multi-pass membrane protein. The function of the C14orf180 protein is not known.

Poids moléculaire: 18 kDa (MW of target protein)