CEACAM16 anticorps (Middle Region)
-
- Antigène Voir toutes CEACAM16 Anticorps
- CEACAM16 (Carcinoembryonic Antigen-Related Cell Adhesion Molecule 16 (CEACAM16))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CEACAM16 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CEACAM16 antibody was raised against the middle region of CEACAM16
- Purification
- Affinity purified
- Immunogène
- CEACAM16 antibody was raised using the middle region of CEACAM16 corresponding to a region with amino acids LLSGSASVVVKLSAAAVATMIVPVPTKPTEGQDVTLTVQGYPKDLLVYAW
- Top Product
- Discover our top product CEACAM16 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CEACAM16 Blocking Peptide, catalog no. 33R-5191, is also available for use as a blocking control in assays to test for specificity of this CEACAM16 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CEACAM16 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CEACAM16 (Carcinoembryonic Antigen-Related Cell Adhesion Molecule 16 (CEACAM16))
- Autre désignation
- CEACAM16 (CEACAM16 Produits)
- Synonymes
- anticorps CEAL2, anticorps DFNA4B, anticorps Gm769, anticorps Bcl3, anticorps carcinoembryonic antigen related cell adhesion molecule 16, anticorps carcinoembryonic antigen-related cell adhesion molecule 16, anticorps CEACAM16, anticorps Ceacam16
- Sujet
- CEACAM16 belongs to the immunoglobulin superfamily, CEA family.
- Poids moléculaire
- 53 kDa (MW of target protein)
- Pathways
- Sensory Perception of Sound
-