NCAM2 anticorps (Middle Region)

N° du produit ABIN635019

Cet anticorps anti-NCAM2 est un anticorps Lapin Polyclonal détectant NCAM2 dans WB. Adapté pour Humain.

Aperçu rapide pour NCAM2 anticorps (Middle Region) (ABIN635019)

Antigène: NCAM2 (Neural Cell Adhesion Molecule 2 (NCAM2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NCAM2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-NCAM2 anticorps

Épitope: Middle Region

Specificité: NCAM2 antibody was raised against the middle region of NCAM2

Purification: Affinity purified

Immunogène: NCAM2 antibody was raised using the middle region of NCAM2 corresponding to a region with amino acids KGQGDYSKIEIFQTLPVREPSPPSIHGQPSSGKSFKLSITKQDDGGAPIL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NCAM2 Blocking Peptide, (ABIN939786), is also available for use as a blocking control in assays to test for specificity of this NCAM2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NCAM2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NCAM2

Antigène: NCAM2 (Neural Cell Adhesion Molecule 2 (NCAM2))

Autre désignation: NCAM2

Sujet: The protein encoded by this gene belongs to the immunoglobulin superfamily. It is a type I membrane protein and may function in selective fasciculation and zone-to-zone projection of the primary olfactory axons.

Poids moléculaire: 91 kDa (MW of target protein)