NCAM2 anticorps (Middle Region)

N° du produit ABIN635019

Détail du produit anti-NCAM2 anticorps

Antigène: NCAM2 (Neural Cell Adhesion Molecule 2 (NCAM2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NCAM2 est non-conjugé

Application: Western Blotting (WB)

Specificité: NCAM2 antibody was raised against the middle region of NCAM2

Purification: Affinity purified

Immunogène: NCAM2 antibody was raised using the middle region of NCAM2 corresponding to a region with amino acids KGQGDYSKIEIFQTLPVREPSPPSIHGQPSSGKSFKLSITKQDDGGAPIL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NCAM2 Blocking Peptide, catalog no. 33R-4400, is also available for use as a blocking control in assays to test for specificity of this NCAM2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NCAM2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NCAM2

Antigène: NCAM2 (Neural Cell Adhesion Molecule 2 (NCAM2))

Autre désignation: NCAM2 (NCAM2 Produits)

Synonymes: anticorps NCAM21, anticorps Ncam-2, anticorps Ocam, anticorps RNCAM, anticorps zOCAM, anticorps OCAM-GPI, anticorps NCAM2, anticorps ncam21, anticorps neural cell adhesion molecule 2, anticorps zgc:152904, anticorps NCAM2, anticorps Ncam2, anticorps ncam2, anticorps LOC100471034, anticorps zgc:152904

Sujet: The protein encoded by this gene belongs to the immunoglobulin superfamily. It is a type I membrane protein and may function in selective fasciculation and zone-to-zone projection of the primary olfactory axons.

Poids moléculaire: 91 kDa (MW of target protein)