ELOVL5 anticorps

N° du produit ABIN635023

Cet anticorps Lapin Polyclonal détecte spécifiquement ELOVL5 dans WB. Il présente une réactivité envers Humain et Souris.

Aperçu rapide pour ELOVL5 anticorps (ABIN635023)

Antigène: ELOVL5 (ELOVL Fatty Acid Elongase 5 (ELOVL5))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ELOVL5 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ELOVL5 anticorps

Purification: Affinity purified

Immunogène: ELOVL5 antibody was raised using a synthetic peptide corresponding to a region with amino acids EHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ELOVL5 Blocking Peptide, (ABIN937837), is also available for use as a blocking control in assays to test for specificity of this ELOVL5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ELOVL5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ELOVL5

Antigène: ELOVL5 (ELOVL Fatty Acid Elongase 5 (ELOVL5))

Autre désignation: ELOVL5

Sujet: ELOVL5 plays a role in elongation of long-chain polyunsaturated fatty acids.ELOVL5 plays a role in elongation of long-chain polyunsaturated fatty acids.

Poids moléculaire: 35 kDa (MW of target protein)