C16orf58 anticorps (N-Term)

N° du produit ABIN635025

Cet anticorps anti-C16orf58 est un anticorps Lapin Polyclonal détectant C16orf58 dans WB. Adapté pour Humain et Souris.

Aperçu rapide pour C16orf58 anticorps (N-Term) (ABIN635025)

Antigène: C16orf58 (Chromosome 16 Open Reading Frame 58 (C16orf58))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C16orf58 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-C16orf58 anticorps

Épitope: N-Term

Specificité: C16 ORF58 antibody was raised against the N terminal Of C16 rf58

Purification: Affinity purified

Immunogène: C16 ORF58 antibody was raised using the N terminal Of C16 rf58 corresponding to a region with amino acids QAVFLPQGFPDSVSPDYLPYQLWDSVQAFASSLSGSLATQAVLLGIGVGN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C16ORF58 Blocking Peptide, (ABIN5612421), is also available for use as a blocking control in assays to test for specificity of this C16ORF58 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF58 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C16orf58

Antigène: C16orf58 (Chromosome 16 Open Reading Frame 58 (C16orf58))

Autre désignation: C16ORF58

Sujet: The function of C16orf58 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 51 kDa (MW of target protein)