ROBO2 anticorps

N° du produit ABIN635030

L’anticorps Lapin Polyclonal anti-ROBO2 a été validé pour WB. Il convient pour détecter ROBO2 dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour ROBO2 anticorps (ABIN635030)

Antigène: ROBO2 (Roundabout, Axon Guidance Receptor, Homolog 2 (ROBO2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ROBO2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ROBO2 anticorps

Purification: Affinity purified

Immunogène: ROBO2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PQPTVRWKKDDADLPRGRYDIKDDYTLRIKKTMSTDEGTYMCIAENRVGK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ROBO2 Blocking Peptide, (ABIN5615914), is also available for use as a blocking control in assays to test for specificity of this ROBO2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ROBO2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ROBO2

Antigène: ROBO2 (Roundabout, Axon Guidance Receptor, Homolog 2 (ROBO2))

Autre désignation: ROBO2

Sujet: ROBO2 belongs to the ROBO family, part of the immunoglobulin superfamily proteins that are highly conserved from fly to human. ROBO2 is a receptor for SLIT2, molecules known to function in axon guidance and cell migration. Defects in this gene are the cause of vesicoureteral reflux type 2. Alternatively spliced transcript variants encoding different isoforms have been described for ROBO2.

Poids moléculaire: 151 kDa (MW of target protein)

Pathways: Regulation of Cell Size