SLC25A38 anticorps (Middle Region)

N° du produit ABIN635042

Détail du produit anti-SLC25A38 anticorps

Antigène: SLC25A38 (Solute Carrier Family 25, Member 38 (SLC25A38))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC25A38 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: SLC25 A38 antibody was raised against the middle region of SLC25 38

Purification: Affinity purified

Immunogène: SLC25 A38 antibody was raised using the middle region of SLC25 38 corresponding to a region with amino acids VGIYFGTLYSLKQYFLRGHPPTALESVMLGVGSRSVAGVCMSPITVIKTR

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC25A38 Blocking Peptide, catalog no. 33R-9563, is also available for use as a blocking control in assays to test for specificity of this SLC25A38 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 38 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC25A38

Antigène: SLC25A38 (Solute Carrier Family 25, Member 38 (SLC25A38))

Autre désignation: SLC25A38 (SLC25A38 Produits)

Synonymes: anticorps AV019094, anticorps BC010801, anticorps RGD1311914, anticorps zgc:153036, anticorps solute carrier family 25 member 38, anticorps solute carrier family 25, member 38, anticorps solute carrier family 25 member 38 L homeolog, anticorps solute carrier family 25, member 38a, anticorps SLC25A38, anticorps Slc25a38, anticorps slc25a38.L, anticorps slc25a38a

Sujet: SLC25A38 is a members of the solute carrier family 25 (SLC25) which is known to transport molecules over the mitochondrial membrane.

Poids moléculaire: 33 kDa (MW of target protein)