CXorf66 anticorps (Middle Region)

N° du produit ABIN635057

L’anticorps anti-CXorf66 Polyclonal produit chez le Lapin a été validé pour WB. Il convient pour la détection de CXorf66 dans des échantillons provenant de Humain. }

Aperçu rapide pour CXorf66 anticorps (Middle Region) (ABIN635057)

Antigène: CXorf66 (Chromosome X Open Reading Frame 66 (CXorf66))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CXorf66 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CXorf66 anticorps

Épitope: Middle Region

Specificité: CXorf66 antibody was raised against the middle region of CXorf66

Purification: Affinity purified

Immunogène: CXorf66 antibody was raised using the middle region of CXorf66 corresponding to a region with amino acids PLYSSHPQNEISPSKPFGPQELAKPPKHFNPKRSVSLGRAALLSNSELAE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CXorf66 Blocking Peptide, (ABIN5613055), is also available for use as a blocking control in assays to test for specificity of this CXorf66 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CXorf66 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CXorf66

Antigène: CXorf66 (Chromosome X Open Reading Frame 66 (CXorf66))

Autre désignation: CXorf66

Sujet: The protein encoded by this gene is predicted to be a type I membrane protein, however, its exact function is not known.

Poids moléculaire: 40 kDa (MW of target protein)