CPT1B anticorps

N° du produit ABIN635060

L’anticorps Lapin Polyclonal anti-CPT1B a été validé pour WB. Il convient pour détecter CPT1B dans des échantillons de Humain.

Aperçu rapide pour CPT1B anticorps (ABIN635060)

Antigène: CPT1B (Carnitine Palmitoyltransferase 1B (Muscle) (CPT1B))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CPT1B est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CPT1B anticorps

Purification: Affinity purified

Immunogène: CPT1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids DLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CPT1B Blocking Peptide, (ABIN937426), is also available for use as a blocking control in assays to test for specificity of this CPT1B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPT0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CPT1B

Antigène: CPT1B (Carnitine Palmitoyltransferase 1B (Muscle) (CPT1B))

Autre désignation: CPT1B

Sujet: The protein encoded by this gene, a member of the carnitine/choline acetyltransferase family, is the rate-controlling enzyme of the long-chain fatty acid beta-oxidation pathway in muscle mitochondria.

Poids moléculaire: 88 kDa (MW of target protein)

Pathways: AMPK Signaling, Monocarboxylic Acid Catabolic Process