CPT1B anticorps
-
- Antigène Voir toutes CPT1B Anticorps
- CPT1B (Carnitine Palmitoyltransferase 1B (Muscle) (CPT1B))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CPT1B est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- CPT1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids DLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAA
- Top Product
- Discover our top product CPT1B Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CPT1B Blocking Peptide, catalog no. 33R-2040, is also available for use as a blocking control in assays to test for specificity of this CPT1B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPT0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CPT1B (Carnitine Palmitoyltransferase 1B (Muscle) (CPT1B))
- Autre désignation
- CPT1B (CPT1B Produits)
- Synonymes
- anticorps CPT1-M, anticorps CPT1M, anticorps CPTI, anticorps CPTI-M, anticorps M-CPT1, anticorps MCCPT1, anticorps MCPT1, anticorps CPT-IB, anticorps M-CPTI, anticorps CPT1, anticorps CPTIB, anticorps cpt1al, anticorps zgc:103709, anticorps CPT1B, anticorps MGC147544, anticorps Cpt1, anticorps Cpt1-m, anticorps Cpti, anticorps Cpti-m, anticorps M-cpti, anticorps carnitine palmitoyltransferase 1B, anticorps carnitine palmitoyltransferase 1B (muscle), anticorps carnitine palmitoyltransferase 1B L homeolog, anticorps carnitine palmitoyltransferase 1b, muscle, anticorps CPT1B, anticorps Cpt1b, anticorps cpt1b, anticorps cpt1b.L
- Sujet
- The protein encoded by this gene, a member of the carnitine/choline acetyltransferase family, is the rate-controlling enzyme of the long-chain fatty acid beta-oxidation pathway in muscle mitochondria.
- Poids moléculaire
- 88 kDa (MW of target protein)
- Pathways
- AMPK Signaling, Monocarboxylic Acid Catabolic Process
-