PEMT anticorps (C-Term)

N° du produit ABIN635064

Détail du produit anti-PEMT anticorps

Antigène: PEMT (Phosphatidylethanolamine N-Methyltransferase (PEMT))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PEMT est non-conjugé

Application: Western Blotting (WB)

Specificité: PEMT antibody was raised against the C terminal of PEMT

Purification: Affinity purified

Immunogène: PEMT antibody was raised using the C terminal of PEMT corresponding to a region with amino acids GWAIMHASPTGLLLTVLVALTYIVALLYEEPFTAEIYRQKASGSHKRS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PEMT Blocking Peptide, catalog no. 33R-3664, is also available for use as a blocking control in assays to test for specificity of this PEMT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PEMT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PEMT

Antigène: PEMT (Phosphatidylethanolamine N-Methyltransferase (PEMT))

Autre désignation: PEMT (PEMT Produits)

Synonymes: anticorps zgc:55479, anticorps DDBDRAFT_0204815, anticorps DDBDRAFT_0267053, anticorps DDB_0204815, anticorps DDB_0267053, anticorps DDBDRAFT_0219474, anticorps DDBDRAFT_0267052, anticorps DDB_0219474, anticorps DDB_0267052, anticorps PEAMT, anticorps PEMPT, anticorps PEMT2, anticorps PNMT, anticorps AI255394, anticorps Pempt, anticorps Pempt2, anticorps PHOMETH, anticorps phosphatidylethanolamine N-methyltransferase, anticorps pemt, anticorps MCA3065, anticorps pmtA, anticorps CNG04250, anticorps pemtA, anticorps pemtB, anticorps PEMT, anticorps Pemt

Sujet: PEMT is an enzyme which converts phosphatidylethanolamine to phosphatidylcholine by sequential methylation in the liver. The protein localizes to the endoplasmic reticulum and mitochondria-associated membranes. The gene encodes PEMT protein is within the Smith-Magenis syndrome region on chromosome 17.

Poids moléculaire: 26 kDa (MW of target protein)