SLC25A32 anticorps (N-Term)

N° du produit ABIN635067

Cet anticorps anti-SLC25A32 est un anticorps Lapin Polyclonal détectant SLC25A32 dans WB. Adapté pour Humain, Souris, Rat et Chien.

Aperçu rapide pour SLC25A32 anticorps (N-Term) (ABIN635067)

Antigène: SLC25A32 (Solute Carrier Family 25, Member 32 (SLC25A32))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC25A32 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SLC25A32 anticorps

Épitope: N-Term

Specificité: SLC25 A32 antibody was raised against the N terminal of SLC25 32

Purification: Affinity purified

Immunogène: SLC25 A32 antibody was raised using the N terminal of SLC25 32 corresponding to a region with amino acids VRYENLIAGVSGGVLSNLALHPLDLVKIRFAVSDGLELRPKYNGILHCLT

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC25A32 Blocking Peptide, (ABIN5616221), is also available for use as a blocking control in assays to test for specificity of this SLC25A32 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 32 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC25A32

Antigène: SLC25A32 (Solute Carrier Family 25, Member 32 (SLC25A32))

Autre désignation: SLC25A32

Sujet: SLC25A21 is a homolog of the S. cerevisiae ODC proteins, mitochondrial carriers that transport C5-C7 oxodicarboxylates across inner mitochondrial membranes. One of the species transported by ODC is 2-oxoadipate, a common intermediate in the catabolism of lysine, tryptophan, and hydroxylysine in mammals.

Poids moléculaire: 35 kDa (MW of target protein)

Pathways: Dicarboxylic Acid Transport