SLC25A32 anticorps (N-Term)

N° du produit ABIN635067

Détail du produit anti-SLC25A32 anticorps

Antigène: SLC25A32 (Solute Carrier Family 25, Member 32 (SLC25A32))

Épitope: N-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC25A32 est non-conjugé

Application: Western Blotting (WB)

Specificité: SLC25 A32 antibody was raised against the N terminal of SLC25 32

Purification: Affinity purified

Immunogène: SLC25 A32 antibody was raised using the N terminal of SLC25 32 corresponding to a region with amino acids VRYENLIAGVSGGVLSNLALHPLDLVKIRFAVSDGLELRPKYNGILHCLT

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC25A32 Blocking Peptide, catalog no. 33R-9795, is also available for use as a blocking control in assays to test for specificity of this SLC25A32 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 32 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC25A32

Antigène: SLC25A32 (Solute Carrier Family 25, Member 32 (SLC25A32))

Autre désignation: SLC25A32 (SLC25A32 Produits)

Synonymes: anticorps fi40c12, anticorps mftc, anticorps wu:fi40c12, anticorps zgc:55610, anticorps zgc:110786, anticorps RGD1565789, anticorps MFT, anticorps MFTC, anticorps 2610043O12Rik, anticorps Mftc, anticorps solute carrier family 25 (mitochondrial folate carrier), member 32a, anticorps solute carrier family 25 (mitochondrial folate carrier), member 32b, anticorps NAD transporter, anticorps mitochondrial folate transporter/carrier, anticorps solute carrier family 25 member 32, anticorps solute carrier family 25 (mitochondrial folate carrier), member 32 L homeolog, anticorps solute carrier family 25, member 32, anticorps slc25a32a, anticorps slc25a32b, anticorps SJAG_04328, anticorps PAAG_07673, anticorps PAAG_03661, anticorps MCYG_01228, anticorps MGYG_01778, anticorps SLC25A32, anticorps Slc25a32, anticorps slc25a32.L

Sujet: SLC25A21 is a homolog of the S. cerevisiae ODC proteins, mitochondrial carriers that transport C5-C7 oxodicarboxylates across inner mitochondrial membranes. One of the species transported by ODC is 2-oxoadipate, a common intermediate in the catabolism of lysine, tryptophan, and hydroxylysine in mammals.

Poids moléculaire: 35 kDa (MW of target protein)

Pathways: Dicarboxylic Acid Transport