LINGO4 anticorps (Middle Region)

N° du produit ABIN635071

Détail du produit anti-LINGO4 anticorps

Antigène: LINGO4 (Leucine Rich Repeat and Ig Domain Containing 4 (LINGO4))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LINGO4 est non-conjugé

Application: Western Blotting (WB)

Specificité: LINGO4 antibody was raised against the middle region of LINGO4

Purification: Affinity purified

Immunogène: LINGO4 antibody was raised using the middle region of LINGO4 corresponding to a region with amino acids TLEIRSVQLRDRGAYVCVVSNVAGNDSLRTWLEVIQVEPPNGTLSDPNIT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LINGO4 Blocking Peptide, catalog no. 33R-9169, is also available for use as a blocking control in assays to test for specificity of this LINGO4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LINGO4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LINGO4

Antigène: LINGO4 (Leucine Rich Repeat and Ig Domain Containing 4 (LINGO4))

Autre désignation: LINGO4 (LINGO4 Produits)

Synonymes: anticorps A530050P17Rik, anticorps LERN4, anticorps Lrrn6d, anticorps RGD1562025, anticorps DAAT9248, anticorps LRRN6D, anticorps PRO34002, anticorps zgc:198379, anticorps leucine rich repeat and Ig domain containing 4, anticorps leucine rich repeat and Ig domain containing 4b, anticorps Lingo4, anticorps LINGO4, anticorps lingo4b

Sujet: The function of LINGO4 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 64 kDa (MW of target protein)