DPP10 anticorps (Middle Region)

N° du produit ABIN635073

Cet anticorps anti-DPP10 est un anticorps Lapin Polyclonal détectant DPP10 dans WB. Adapté pour Humain.

Aperçu rapide pour DPP10 anticorps (Middle Region) (ABIN635073)

Antigène: DPP10 (Dipeptidylpeptidase 10 (DPP10))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DPP10 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-DPP10 anticorps

Épitope: Middle Region

Specificité: DPP10 antibody was raised against the middle region of DPP10

Purification: Affinity purified

Immunogène: DPP10 antibody was raised using the middle region of DPP10 corresponding to a region with amino acids VNYTMQVYPDEGHNVSEKSKYHLYSTILKFFSDCLKEEISVLPQEPEEDE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DPP10 Blocking Peptide, (ABIN5613247), is also available for use as a blocking control in assays to test for specificity of this DPP10 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPP10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DPP10

Antigène: DPP10 (Dipeptidylpeptidase 10 (DPP10))

Autre désignation: DPP10

Sujet: DPP10 is a single-pass type II membrane protein that is a member of the S9B family in clan SC of the serine proteases. This protein has no detectable protease activity, most likely due to the absence of the conserved serine residue normally present in the catalytic domain of serine proteases. However, it does bind specific voltage-gated potassium channels and alters their expression and biophysical properties. Mutations in this gene have been associated with asthma.

Poids moléculaire: 90 kDa (MW of target protein)