DPP10 anticorps (Middle Region)
-
- Antigène Voir toutes DPP10 Anticorps
- DPP10 (Dipeptidylpeptidase 10 (DPP10))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DPP10 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- DPP10 antibody was raised against the middle region of DPP10
- Purification
- Affinity purified
- Immunogène
- DPP10 antibody was raised using the middle region of DPP10 corresponding to a region with amino acids VNYTMQVYPDEGHNVSEKSKYHLYSTILKFFSDCLKEEISVLPQEPEEDE
- Top Product
- Discover our top product DPP10 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DPP10 Blocking Peptide, catalog no. 33R-9716, is also available for use as a blocking control in assays to test for specificity of this DPP10 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPP10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DPP10 (Dipeptidylpeptidase 10 (DPP10))
- Autre désignation
- DPP10 (DPP10 Produits)
- Synonymes
- anticorps DPL2, anticorps DPPY, anticorps DPRP3, anticorps DPP10, anticorps MGC84485, anticorps 6430601K09Rik, anticorps DPP X, anticorps Dprp3, anticorps dipeptidyl peptidase like 10, anticorps dipeptidyl-peptidase 10 (inactive) L homeolog, anticorps dipeptidylpeptidase 10, anticorps DPP10, anticorps dpp10.L, anticorps Dpp10
- Sujet
- DPP10 is a single-pass type II membrane protein that is a member of the S9B family in clan SC of the serine proteases. This protein has no detectable protease activity, most likely due to the absence of the conserved serine residue normally present in the catalytic domain of serine proteases. However, it does bind specific voltage-gated potassium channels and alters their expression and biophysical properties. Mutations in this gene have been associated with asthma.
- Poids moléculaire
- 90 kDa (MW of target protein)
-