SLC39A8 anticorps

N° du produit ABIN635083

Cet anticorps Lapin Polyclonal détecte spécifiquement SLC39A8 dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour SLC39A8 anticorps (ABIN635083)

Antigène: SLC39A8 (Solute Carrier Family 39 (Zinc Transporter), Member 8 (SLC39A8))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC39A8 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SLC39A8 anticorps

Purification: Affinity purified

Immunogène: SLC39 A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids QLNFHPCEDRPKHKTRPSHSEVWGYGFLSVTIINLASLLGLILTPLIKKS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC39A8 Blocking Peptide, (ABIN5616251), is also available for use as a blocking control in assays to test for specificity of this SLC39A8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC39A8

Antigène: SLC39A8 (Solute Carrier Family 39 (Zinc Transporter), Member 8 (SLC39A8))

Autre désignation: SLC39A8

Sujet: This gene encodes a member of the SLC39 family of solute-carrier genes, which show structural characteristics of zinc transporters. The encoded protein is glycosylated and found in the plasma membrane and mitochondria, and functions in the cellular import

Poids moléculaire: 50 kDa (MW of target protein)