SLC25A22 anticorps

N° du produit ABIN635084

L’anticorps Lapin Polyclonal anti-SLC25A22 a été validé pour WB. Il convient pour détecter SLC25A22 dans des échantillons de Humain.

Aperçu rapide pour SLC25A22 anticorps (ABIN635084)

Antigène: SLC25A22 (Solute Carrier Family 25 (Mitochondrial Carrier: Glutamate), Member 22 (SLC25A22))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC25A22 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SLC25A22 anticorps

Purification: Affinity purified

Immunogène: SLC25 A22 antibody was raised using a synthetic peptide corresponding to a region with amino acids VNLTLVTPEKAIKLAANDFFRHQLSKDGQKLTLLKEMLAGCGAGTCQVIV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC25A22 Blocking Peptide, (ABIN5616215), is also available for use as a blocking control in assays to test for specificity of this SLC25A22 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 22 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC25A22

Antigène: SLC25A22 (Solute Carrier Family 25 (Mitochondrial Carrier: Glutamate), Member 22 (SLC25A22))

Autre désignation: SLC25A22

Sujet: The SLC25 family is mitochondrial carriers that transport a variety of metabolites across the inner mitochondrial membrane. SLC25A22, also known as GC1, is 1 of the 2 mitochondrial glutamate/H+ symporters, the other being SLC25A18.

Poids moléculaire: 34 kDa (MW of target protein)

Pathways: Dicarboxylic Acid Transport