SLC25A22 anticorps

N° du produit ABIN635084

Détail du produit anti-SLC25A22 anticorps

Antigène: SLC25A22 (Solute Carrier Family 25 (Mitochondrial Carrier: Glutamate), Member 22 (SLC25A22))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC25A22 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: SLC25 A22 antibody was raised using a synthetic peptide corresponding to a region with amino acids VNLTLVTPEKAIKLAANDFFRHQLSKDGQKLTLLKEMLAGCGAGTCQVIV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC25A22 Blocking Peptide, catalog no. 33R-9708, is also available for use as a blocking control in assays to test for specificity of this SLC25A22 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 22 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC25A22

Antigène: SLC25A22 (Solute Carrier Family 25 (Mitochondrial Carrier: Glutamate), Member 22 (SLC25A22))

Autre désignation: SLC25A22 (SLC25A22 Produits)

Synonymes: anticorps 1300006L01Rik, anticorps AI060884, anticorps Gc1, anticorps GC1, anticorps RGD1307826, anticorps EIEE3, anticorps NET44, anticorps solute carrier family 25 (mitochondrial carrier, glutamate), member 22, anticorps solute carrier family 25 member 22, anticorps Slc25a22, anticorps SLC25A22

Sujet: The SLC25 family is mitochondrial carriers that transport a variety of metabolites across the inner mitochondrial membrane. SLC25A22, also known as GC1, is 1 of the 2 mitochondrial glutamate/H+ symporters, the other being SLC25A18.

Poids moléculaire: 34 kDa (MW of target protein)

Pathways: Dicarboxylic Acid Transport