SLC25A46 anticorps (C-Term)

N° du produit ABIN635085

Détail du produit anti-SLC25A46 anticorps

Antigène: SLC25A46 (Solute Carrier Family 25, Member 46 (SLC25A46))

Épitope: C-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC25A46 est non-conjugé

Application: Western Blotting (WB)

Specificité: SLC25 A46 antibody was raised against the C terminal of SLC25 46

Purification: Affinity purified

Immunogène: SLC25 A46 antibody was raised using the C terminal of SLC25 46 corresponding to a region with amino acids LKRKTYNSHLAESTSPVQSMLDAYFPELIANFAASLCSDVILYPLETVLH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC25A46 Blocking Peptide, catalog no. 33R-5100, is also available for use as a blocking control in assays to test for specificity of this SLC25A46 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 46 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC25A46

Antigène: SLC25A46 (Solute Carrier Family 25, Member 46 (SLC25A46))

Autre désignation: SLC25A46 (SLC25A46 Produits)

Synonymes: anticorps SLC25A46, anticorps MGC152354, anticorps zgc:92767, anticorps slc25a46, anticorps 1200007B05Rik, anticorps AI325987, anticorps RGD1305072, anticorps solute carrier family 25 member 46, anticorps solute carrier family 25, member 46, anticorps solute carrier family 25 member 46 L homeolog, anticorps SLC25A46, anticorps slc25a46, anticorps slc25a46.L, anticorps Slc25a46

Sujet: SLC25A46 is a members of the solute carrier family 25 (SLC25) which is known to transport molecules over the mitochondrial membrane.SLC25A46 belongs to the SLC25 family of mitochondrial carrier proteins.

Poids moléculaire: 46 kDa (MW of target protein)