SLC25A34 anticorps (Middle Region)

N° du produit ABIN635088

Cet anticorps anti-SLC25A34 est un anticorps Lapin Polyclonal détectant SLC25A34 dans WB. Adapté pour Humain et Souris.

Aperçu rapide pour SLC25A34 anticorps (Middle Region) (ABIN635088)

Antigène: SLC25A34 (Solute Carrier Family 25, Member 34 (SLC25A34))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC25A34 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SLC25A34 anticorps

Épitope: Middle Region

Specificité: SLC25 A34 antibody was raised against the middle region of SLC25 34

Purification: Affinity purified

Immunogène: SLC25 A34 antibody was raised using the middle region of SLC25 34 corresponding to a region with amino acids TDCMVKIWRQEGPLALYKGLGPAYLRLGPHTILSMLFWDELRKLAGRAQH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC25A34 Blocking Peptide, (ABIN5616222), is also available for use as a blocking control in assays to test for specificity of this SLC25A34 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 34 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC25A34

Antigène: SLC25A34 (Solute Carrier Family 25, Member 34 (SLC25A34))

Autre désignation: SLC25A34

Sujet: SLC25A35 belongs to the mitochondrial carrier family. It contains 3 Solcar repeats. It is a multi-pass membrane protein. The functions of SLC25A35 remain unknown.SLC25A35 belongs to the SLC25 family of mitochondrial carrier proteins.

Poids moléculaire: 32 kDa (MW of target protein)