CPT1A anticorps

N° du produit ABIN635089

Détail du produit anti-CPT1A anticorps

Antigène: CPT1A (Carnitine Palmitoyltransferase 1A (Liver) (CPT1A))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CPT1A est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: CPT1 A antibody was raised using a synthetic peptide corresponding to a region with amino acids LSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGYGVSYILVGENLIN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CPT1A Blocking Peptide, catalog no. 33R-5461, is also available for use as a blocking control in assays to test for specificity of this CPT1A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPT0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CPT1A

Antigène: CPT1A (Carnitine Palmitoyltransferase 1A (Liver) (CPT1A))

Autre désignation: CPT1A (CPT1A Produits)

Synonymes: anticorps MGC53498, anticorps CPT1, anticorps CPT1-L, anticorps L-CPT1, anticorps L-CPTI, anticorps si:dkey-56p7.8, anticorps C730027G07, anticorps CPTI, anticorps Cpt1, anticorps CPT-Ia, anticorps carnitine palmitoyltransferase 1A (liver) L homeolog, anticorps carnitine palmitoyltransferase 1A, anticorps carnitine palmitoyltransferase 1A (liver), anticorps carnitine palmitoyltransferase 1Aa (liver), anticorps carnitine palmitoyltransferase 1a, liver, anticorps cpt1a.L, anticorps CPT1A, anticorps cpt1a, anticorps cpt1aa, anticorps Cpt1a

Sujet: The mitochondrial oxidation of long-chain fatty acids is initiated by the sequential action of carnitine palmitoyltransferase I (which is located in the outer membrane and is detergent-labile) and carnitine palmitoyltransferase II (which is located in the inner membrane and is detergent-stable), together with a carnitine-acylcarnitine translocase. CPT I is the key enzyme in the carnitine-dependent transport across the mitochondrial inner membrane and its deficiency results in a decreased rate of fatty acid beta-oxidation.

Poids moléculaire: 86 kDa (MW of target protein)

Pathways: AMPK Signaling, Regulation of Lipid Metabolism by PPARalpha, Feeding Behaviour, Monocarboxylic Acid Catabolic Process