COQ2 anticorps

N° du produit ABIN635093

L’anticorps Lapin Polyclonal anti-COQ2 a été validé pour WB. Il convient pour détecter COQ2 dans des échantillons de Humain.

Aperçu rapide pour COQ2 anticorps (ABIN635093)

Antigène: COQ2 (Coenzyme Q2 Homolog, Prenyltransferase (COQ2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp COQ2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-COQ2 anticorps

Purification: Affinity purified

Immunogène: COQ2 antibody was raised using a synthetic peptide corresponding to a region with amino acids FSGVMWTLIYDTIYAHQDKRDDVLIGLKSTALRFGENTKPWLSGFSVAML

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

COQ2 Blocking Peptide, (ABIN938447), is also available for use as a blocking control in assays to test for specificity of this COQ2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COQ2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur COQ2

Antigène: COQ2 (Coenzyme Q2 Homolog, Prenyltransferase (COQ2))

Autre désignation: COQ2

Sujet: COQ2 catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. COQ2 mediates the second step in the final reaction sequence of coenzyme Q (CoQ) biosynthesis, which is the condensation of the polyisoprenoid side chain with PHB.

Poids moléculaire: 42 kDa (MW of target protein)