DLG3 anticorps
-
- Antigène Voir toutes DLG3 Anticorps
- DLG3 (Discs, Large Homolog 3 (DLG3))
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DLG3 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- DLG3 antibody was raised using a synthetic peptide corresponding to a region with amino acids FPHKFGSCVPHTTRPRRDNEVDGQDYHFVVSREQMEKDIQDNKFIEAGQF
- Top Product
- Discover our top product DLG3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DLG3 Blocking Peptide, catalog no. 33R-3018, is also available for use as a blocking control in assays to test for specificity of this DLG3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLG3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DLG3 (Discs, Large Homolog 3 (DLG3))
- Autre désignation
- DLG3 (DLG3 Produits)
- Synonymes
- anticorps MRX, anticorps MRX90, anticorps NEDLG, anticorps SAP102, anticorps XLMR, anticorps DLG3, anticorps fa66c08, anticorps fa66e02, anticorps fd02c12, anticorps fu95c12, anticorps im:7138640, anticorps si:ch211-276g21.1, anticorps wu:fa66c08, anticorps wu:fa66e02, anticorps wu:fd02c12, anticorps wu:fu95c12, anticorps Dlgh3, anticorps mKIAA1232, anticorps MPP3, anticorps 6430514B01, anticorps CSG18, anticorps Dlg3, anticorps Dusp3, anticorps discs large MAGUK scaffold protein 3, anticorps membrane palmitoylated protein 3, anticorps discs, large homolog 3 (Drosophila), anticorps membrane protein, palmitoylated 3 (MAGUK p55 subfamily member 3), anticorps DLG3, anticorps MPP3, anticorps dlg3, anticorps Dlg3, anticorps Mpp3
- Sujet
- DLG3 is required for learning most likely through its role in synaptic plasticity following NMDA receptor signaling. Defects in DLG3 are the cause of mental retardation X-linked type 90 (MRX90).
- Poids moléculaire
- 90 kDa (MW of target protein)
-