MS4A14 anticorps (Middle Region)

N° du produit ABIN635103

Cet anticorps anti-MS4A14 est un anticorps Lapin Polyclonal détectant MS4A14 dans WB. Adapté pour Humain.

Aperçu rapide pour MS4A14 anticorps (Middle Region) (ABIN635103)

Antigène: MS4A14 (Membrane-Spanning 4-Domains, Subfamily A, Member 14 (MS4A14))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MS4A14 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MS4A14 anticorps

Épitope: Middle Region

Specificité: NYD-SP21 antibody was raised against the middle region of Nyd-Sp21

Purification: Affinity purified

Immunogène: NYD-SP21 antibody was raised using the middle region of Nyd-Sp21 corresponding to a region with amino acids QYPEGQSKDGQVKDQQTDKEQNSKKQTQDQQTEDQPAQEKKSPKGQFQNV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NYD-SP21 Blocking Peptide, (ABIN5615096), is also available for use as a blocking control in assays to test for specificity of this NYD-SP21 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NYD-SP21 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MS4A14

Antigène: MS4A14 (Membrane-Spanning 4-Domains, Subfamily A, Member 14 (MS4A14))

Autre désignation: NYD-SP21

Sujet: NYD-SP21 may be involved in signal transduction as a component of a multimeric receptor complex.

Poids moléculaire: 76 kDa (MW of target protein)