MS4A14 anticorps (Middle Region)
-
- Antigène Voir toutes MS4A14 Anticorps
- MS4A14 (Membrane-Spanning 4-Domains, Subfamily A, Member 14 (MS4A14))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MS4A14 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- NYD-SP21 antibody was raised against the middle region of Nyd-Sp21
- Purification
- Affinity purified
- Immunogène
- NYD-SP21 antibody was raised using the middle region of Nyd-Sp21 corresponding to a region with amino acids QYPEGQSKDGQVKDQQTDKEQNSKKQTQDQQTEDQPAQEKKSPKGQFQNV
- Top Product
- Discover our top product MS4A14 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NYD-SP21 Blocking Peptide, catalog no. 33R-7792, is also available for use as a blocking control in assays to test for specificity of this NYD-SP21 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NYD-SP21 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MS4A14 (Membrane-Spanning 4-Domains, Subfamily A, Member 14 (MS4A14))
- Autre désignation
- NYD-SP21 (MS4A14 Produits)
- Synonymes
- anticorps Sp3111, anticorps Gm1276, anticorps SP3111, anticorps NYD-SP21, anticorps MGC137320, anticorps MS4A16, anticorps membrane spanning 4-domains A14, anticorps membrane-spanning 4-domains, subfamily A, member 14, anticorps Ms4a14, anticorps MS4A14
- Sujet
- NYD-SP21 may be involved in signal transduction as a component of a multimeric receptor complex.
- Poids moléculaire
- 76 kDa (MW of target protein)
-