SLC46A1 anticorps

N° du produit ABIN635109

Cet anticorps anti-SLC46A1 est un anticorps Lapin Polyclonal détectant SLC46A1 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour SLC46A1 anticorps (ABIN635109)

Antigène: SLC46A1 (Solute Carrier Family 46 (Folate Transporter), Member 1 (SLC46A1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC46A1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SLC46A1 anticorps

Purification: Affinity purified

Immunogène: SLC46 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MEGSASPPEKPRARPAAAVLCRGPVEPLVFLANFALVLQGPLTTQYLWHR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC46A1 Blocking Peptide, (ABIN5616259), is also available for use as a blocking control in assays to test for specificity of this SLC46A1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC40 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC46A1

Antigène: SLC46A1 (Solute Carrier Family 46 (Folate Transporter), Member 1 (SLC46A1))

Autre désignation: SLC46A1

Sujet: This gene encodes a transmembrane proton-coupled folate transporter protein that facilitates the movement of folate and antifolate substrates across cell membranes optimally in acidic pH environments.

Poids moléculaire: 50 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis, Dicarboxylic Acid Transport