SLC46A1 anticorps

N° du produit ABIN635109

Détail du produit anti-SLC46A1 anticorps

Antigène: SLC46A1 (Solute Carrier Family 46 (Folate Transporter), Member 1 (SLC46A1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC46A1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: SLC46 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MEGSASPPEKPRARPAAAVLCRGPVEPLVFLANFALVLQGPLTTQYLWHR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC46A1 Blocking Peptide, catalog no. 33R-5921, is also available for use as a blocking control in assays to test for specificity of this SLC46A1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC40 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC46A1

Antigène: SLC46A1 (Solute Carrier Family 46 (Folate Transporter), Member 1 (SLC46A1))

Autre désignation: SLC46A1 (SLC46A1 Produits)

Synonymes: anticorps G21, anticorps HCP1, anticorps PCFT, anticorps RGD1309472, anticorps TRPE, anticorps 1110002C08Rik, anticorps D11Ertd18e, anticorps Pcft, anticorps solute carrier family 46 member 1, anticorps solute carrier family 46 (folate transporter), member 1, anticorps solute carrier family 46, member 1, anticorps SLC46A1, anticorps slc46a1, anticorps Slc46a1

Sujet: This gene encodes a transmembrane proton-coupled folate transporter protein that facilitates the movement of folate and antifolate substrates across cell membranes optimally in acidic pH environments.

Poids moléculaire: 50 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis, Dicarboxylic Acid Transport