DIRC2 anticorps (Middle Region)
-
- Antigène Voir toutes DIRC2 Anticorps
- DIRC2 (Disrupted in Renal Carcinoma 2 (DIRC2))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DIRC2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- DIRC2 antibody was raised against the middle region of DIRC2
- Purification
- Affinity purified
- Immunogène
- DIRC2 antibody was raised using the middle region of DIRC2 corresponding to a region with amino acids AAESSRAHIKDRIEAVLYAEFGVVCLIFSATLAYFPPRPPLPPSVAAASQ
- Top Product
- Discover our top product DIRC2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DIRC2 Blocking Peptide, catalog no. 33R-1018, is also available for use as a blocking control in assays to test for specificity of this DIRC2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DIRC2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DIRC2 (Disrupted in Renal Carcinoma 2 (DIRC2))
- Autre désignation
- DIRC2 (DIRC2 Produits)
- Sujet
- DIRC2 is a membrane-bound protein from the major facilitator superfamily of transporters. Disruption of DIRC2 by translocation has been associated with haplo-insufficiency and renal cell carcinomas. Alternatively spliced transcript variants have been described, but their biological validity has not yet been determined.
- Poids moléculaire
- 52 kDa (MW of target protein)
-