UNC50 anticorps

N° du produit ABIN635144

L’anticorps Lapin Polyclonal anti-UNC50 a été validé pour WB. Il convient pour détecter UNC50 dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour UNC50 anticorps (ABIN635144)

Antigène: UNC50 (Unc-50 Homolog (UNC50))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UNC50 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-UNC50 anticorps

Purification: Affinity purified

Immunogène: UNC50 antibody was raised using a synthetic peptide corresponding to a region with amino acids LPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UNC50 Blocking Peptide, (ABIN5616910), is also available for use as a blocking control in assays to test for specificity of this UNC50 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UNC50 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UNC50

Antigène: UNC50 (Unc-50 Homolog (UNC50))

Autre désignation: UNC50

Sujet: UNC50 belongs to the unc-50 family. It binds RNA. UNC50 may be involved in cell surface expression of neuronal nicotinic receptors.

Poids moléculaire: 30 kDa (MW of target protein)