UNC50 anticorps

N° du produit ABIN635144

Détail du produit anti-UNC50 anticorps

Antigène: UNC50 (Unc-50 Homolog (UNC50))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UNC50 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: UNC50 antibody was raised using a synthetic peptide corresponding to a region with amino acids LPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UNC50 Blocking Peptide, catalog no. 33R-5291, is also available for use as a blocking control in assays to test for specificity of this UNC50 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UNC50 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UNC50

Antigène: UNC50 (Unc-50 Homolog (UNC50))

Autre désignation: UNC50 (UNC50 Produits)

Synonymes: anticorps GMH1, anticorps UNCL, anticorps URP, anticorps 1110002A21Rik, anticorps Uncl, anticorps zgc:56114, anticorps gmh1, anticorps unc50, anticorps uncl, anticorps urp, anticorps unc-50 inner nuclear membrane RNA binding protein, anticorps unc-50 homolog (C. elegans), anticorps protein unc-50 homolog, anticorps unc-50 homolog L homeolog, anticorps unc-50 homolog S homeolog, anticorps UNC50, anticorps Unc50, anticorps unc50, anticorps LOC550684, anticorps LOC100161482, anticorps unc50.L, anticorps unc50.S

Sujet: UNC50 belongs to the unc-50 family. It binds RNA. UNC50 may be involved in cell surface expression of neuronal nicotinic receptors.

Poids moléculaire: 30 kDa (MW of target protein)