TMEM144 anticorps (Middle Region)

N° du produit ABIN635148

Cet anticorps anti-TMEM144 est un anticorps Lapin Polyclonal détectant TMEM144 dans WB. Adapté pour Humain et Rat.

Aperçu rapide pour TMEM144 anticorps (Middle Region) (ABIN635148)

Antigène: TMEM144 (Transmembrane Protein 144 (TMEM144))

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM144 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TMEM144 anticorps

Épitope: Middle Region

Specificité: TMEM144 antibody was raised against the middle region of TMEM144

Purification: Affinity purified

Immunogène: TMEM144 antibody was raised using the middle region of TMEM144 corresponding to a region with amino acids LSTVHHRIVGCSLAVISGVLYGSTFVPIIYIKDHSKRNDSIYAGASQYDL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM144 Blocking Peptide, (ABIN5616665), is also available for use as a blocking control in assays to test for specificity of this TMEM144 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM144 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMEM144

Antigène: TMEM144 (Transmembrane Protein 144 (TMEM144))

Autre désignation: TMEM144

Sujet: The function of the TMEM144 protein remains unknown.

Poids moléculaire: 38 kDa (MW of target protein)