DNAJC10 anticorps

N° du produit ABIN635149

Détail du produit anti-DNAJC10 anticorps

Antigène: DNAJC10 (DnaJ (Hsp40) Homolog, Subfamily C, Member 10 (DNAJC10))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DNAJC10 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: DNAJC10 antibody was raised using a synthetic peptide corresponding to a region with amino acids DFYSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNAHGDFLKINRAY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DNAJC10 Blocking Peptide, catalog no. 33R-1941, is also available for use as a blocking control in assays to test for specificity of this DNAJC10 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNAJC10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DNAJC10

Antigène: DNAJC10 (DnaJ (Hsp40) Homolog, Subfamily C, Member 10 (DNAJC10))

Autre désignation: DNAJC10 (DNAJC10 Produits)

Synonymes: anticorps ERdj5, anticorps JPDI, anticorps MTHr, anticorps PDIA19, anticorps 1200006L06Rik, anticorps D2Ertd706e, anticorps dnajc10, anticorps zgc:162218, anticorps DnaJ heat shock protein family (Hsp40) member C10, anticorps DnaJ (Hsp40) homolog, subfamily C, member 10, anticorps DNAJC10, anticorps Dnajc10, anticorps dnajc10

Sujet: This endoplasmic reticulum co-chaperone may play a role in protein folding and translocation across the endoplasmic reticulum membrane. DNAJC10 may act as a co-chaperone for HSPA5.

Poids moléculaire: 91 kDa (MW of target protein)

Pathways: Cell RedoxHomeostasis