PANX1 anticorps (Middle Region)

N° du produit ABIN635152

Cet anticorps Lapin Polyclonal détecte spécifiquement PANX1 dans WB et IHC. Il présente une réactivité envers Mammifères.

Aperçu rapide pour PANX1 anticorps (Middle Region) (ABIN635152)

Antigène: PANX1 (Pannexin 1 (PANX1))

Reactivité: Mammifères

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PANX1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-PANX1 anticorps

Épitope: Middle Region

Specificité: Pannexin 1 antibody was raised against the middle region of PANX1

Réactivité croisée: Humain

Purification: Affinity purified

Immunogène: Pannexin 1 antibody was raised using the middle region of PANX1 corresponding to a region with amino acids LGYYFSLSSLSDEFVCSIKSGILRNDSTVPDQFQCKLIAVGIFQLLSVIN

Information d'application

Indications d'application: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Pannexin 1 Blocking Peptide, (ABIN940391), is also available for use as a blocking control in assays to test for specificity of this Pannexin 1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PANX1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PANX1

Antigène: PANX1 (Pannexin 1 (PANX1))

Autre désignation: Pannexin 1

Sujet: PANX1 belongs to the innexin family. Innexin family members are the structural components of gap junctions. This protein and pannexin 2 are abundantly expressed in central nerve system (CNS) and are coexpressed in various neuronal populations. Studies in Xenopus oocytes suggest that this protein alone and in combination with pannexin 2 may form cell type-specific gap junctions with distinct properties.

Poids moléculaire: 47 kDa (MW of target protein)