PORCN anticorps

N° du produit ABIN635157

Cet anticorps anti-PORCN est un anticorps Lapin Polyclonal détectant PORCN dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour PORCN anticorps (ABIN635157)

Antigène: PORCN (Porcupine Homolog (PORCN))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PORCN est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PORCN anticorps

Purification: Affinity purified

Immunogène: PORCN antibody was raised using a synthetic peptide corresponding to a region with amino acids ACRLLWRLGLPSYLKHASTVAGGFFSLYHFFQLHMVWVVLLSLLCYLVLF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PORCN Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this PORCN antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PORCN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PORCN

Antigène: PORCN (Porcupine Homolog (PORCN))

Autre désignation: PORCN

Sujet: PORCN belongs to the evolutionarily conserved porcupine (Porc) gene family. Genes of the Porc family encode endoplasmic reticulum proteins with multiple transmembrane domains. Porcupine proteins are involved in the processing of Wnt (wingless and int homologue) proteins. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed.

Poids moléculaire: 51 kDa (MW of target protein)