C14orf180 anticorps (N-Term)
-
- Antigène Tous les produits C14orf180
- C14orf180 (Chromosome 14 Open Reading Frame 180 (C14orf180))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp C14orf180 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- C14 ORF180 antibody was raised against the N terminal Of C14 rf180
- Purification
- Affinity purified
- Immunogène
- C14 ORF180 antibody was raised using the N terminal Of C14 rf180 corresponding to a region with amino acids RTAAGAVSPDSRPETRRQTRKNEEAAWGPRVCRAEREDNRKCPPSILKRS
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
C14ORF180 Blocking Peptide, catalog no. 33R-8218, is also available for use as a blocking control in assays to test for specificity of this C14ORF180 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF180 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- C14orf180 (Chromosome 14 Open Reading Frame 180 (C14orf180))
- Autre désignation
- C14ORF180 (C14orf180 Produits)
- Synonymes
- anticorps C14orf77, anticorps NRAC, anticorps Nrac, anticorps C21H14orf180, anticorps chromosome 14 open reading frame 180, anticorps RIKEN cDNA A530016L24 gene, anticorps chromosome 21 open reading frame, human C14orf180, anticorps C14orf180, anticorps A530016L24Rik, anticorps C21H14orf180
- Sujet
- C14orf180 is a multi-pass membrane protein. The function of the C14orf180 protein is not known.
- Poids moléculaire
- 18 kDa (MW of target protein)
-