TMEM75 anticorps (C-Term)

N° du produit ABIN635165

Détail du produit anti-TMEM75 anticorps

Antigène: TMEM75 (Transmembrane Protein 75 (TMEM75))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM75 est non-conjugé

Application: Western Blotting (WB)

Specificité: TMEM75 antibody was raised against the C terminal of TMEM75

Purification: Affinity purified

Immunogène: TMEM75 antibody was raised using the C terminal of TMEM75 corresponding to a region with amino acids VTISQDSETLSLDCDHRLFFSLPFTDPASGGQSQHSWPCPERSKNLPQVS

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM75 Blocking Peptide, catalog no. 33R-9846, is also available for use as a blocking control in assays to test for specificity of this TMEM75 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM75 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMEM75

Antigène: TMEM75 (Transmembrane Protein 75 (TMEM75))

Autre désignation: TMEM75 (TMEM75 Produits)

Synonymes: anticorps transmembrane protein 75, anticorps TMEM75

Sujet: The function of TMEM75 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 15 kDa (MW of target protein)