LRRC26 anticorps (Middle Region)

N° du produit ABIN635168

Détail du produit anti-LRRC26 anticorps

Antigène: LRRC26 (Leucine Rich Repeat Containing 26 (LRRC26))

Épitope: Middle Region

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LRRC26 est non-conjugé

Application: Western Blotting (WB)

Specificité: LRRC26 antibody was raised against the middle region of Lrrc26

Purification: Affinity purified

Immunogène: LRRC26 antibody was raised using the middle region of Lrrc26 corresponding to a region with amino acids LRPLCAWLRRHPLPASEAETVLCVWPGRLTLSPLTAFSDAAFSHCAQPLA

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LRRC26 Blocking Peptide, catalog no. 33R-5378, is also available for use as a blocking control in assays to test for specificity of this LRRC26 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC26 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LRRC26

Antigène: LRRC26 (Leucine Rich Repeat Containing 26 (LRRC26))

Autre désignation: LRRC26 (LRRC26 Produits)

Synonymes: anticorps LRRC26, anticorps CAPC, anticorps bA350O14.10, anticorps RP23-132N23.19, anticorps RGD1308398, anticorps leucine rich repeat containing 26, anticorps LRRC26, anticorps Lrrc26

Sujet: LRRC26 is an auxiliary protein of the large-conductance, voltage and calcium-activated potassium channel (BK alpha), required for the conversion of BK alpha channels from a high-voltage to a low-voltage activated channel type in non-excitable cells. These are characterized by negative membrane voltages and constant low levels of calcium.

Poids moléculaire: 37 kDa (MW of target protein)