SLC41A1 anticorps (N-Term)

N° du produit ABIN635173

Cet anticorps Lapin Polyclonal détecte spécifiquement SLC41A1 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour SLC41A1 anticorps (N-Term) (ABIN635173)

Antigène: SLC41A1 (Solute Carrier Family 41, Member 1 (SLC41A1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC41A1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SLC41A1 anticorps

Épitope: N-Term

Specificité: SLC41 A1 antibody was raised against the N terminal of SLC41 1

Purification: Affinity purified

Immunogène: SLC41 A1 antibody was raised using the N terminal of SLC41 1 corresponding to a region with amino acids TSEFLGPDGAGVEVVIESRANAKGVREEDALLENGSQSNESDDVSTDRGP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC41A1 Blocking Peptide, (ABIN5616252), is also available for use as a blocking control in assays to test for specificity of this SLC41A1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC40 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC41A1

Antigène: SLC41A1 (Solute Carrier Family 41, Member 1 (SLC41A1))

Autre désignation: SLC41A1

Sujet: SLC41A1 belongs to the SLC41A transporter family. It acts as a magnesium transporter that is responsive to magnesium balance.

Poids moléculaire: 55 kDa (MW of target protein)