SLC41A1 anticorps (N-Term)

N° du produit ABIN635173

Détail du produit anti-SLC41A1 anticorps

Antigène: SLC41A1 (Solute Carrier Family 41, Member 1 (SLC41A1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC41A1 est non-conjugé

Application: Western Blotting (WB)

Specificité: SLC41 A1 antibody was raised against the N terminal of SLC41 1

Purification: Affinity purified

Immunogène: SLC41 A1 antibody was raised using the N terminal of SLC41 1 corresponding to a region with amino acids TSEFLGPDGAGVEVVIESRANAKGVREEDALLENGSQSNESDDVSTDRGP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC41A1 Blocking Peptide, catalog no. 33R-9280, is also available for use as a blocking control in assays to test for specificity of this SLC41A1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC40 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC41A1

Antigène: SLC41A1 (Solute Carrier Family 41, Member 1 (SLC41A1))

Autre désignation: SLC41A1 (SLC41A1 Produits)

Synonymes: anticorps fd54c09, anticorps wu:fd54c09, anticorps MgtE, anticorps AI573938, anticorps B230315F01Rik, anticorps solute carrier family 41 (magnesium transporter), member 1, anticorps solute carrier family 41 member 1, anticorps solute carrier family 41, member 1, anticorps slc41a1, anticorps SLC41A1, anticorps Slc41a1

Sujet: SLC41A1 belongs to the SLC41A transporter family. It acts as a magnesium transporter that is responsive to magnesium balance.

Poids moléculaire: 55 kDa (MW of target protein)