DLG3 anticorps

N° du produit ABIN635177

L’anticorps Lapin Polyclonal anti-DLG3 a été validé pour WB. Il convient pour détecter DLG3 dans des échantillons de Humain, Rat et Souris.

Aperçu rapide pour DLG3 anticorps (ABIN635177)

Antigène: DLG3 (Discs, Large Homolog 3 (DLG3))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DLG3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-DLG3 anticorps

Purification: Affinity purified

Immunogène: DLG3 antibody was raised using a synthetic peptide corresponding to a region with amino acids HEQAAAALKRAGQSVTIVAQYRPEEYSRFESKIHDLREQMMNSSMSSGSG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DLG3 Blocking Peptide, (ABIN939108), is also available for use as a blocking control in assays to test for specificity of this DLG3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLG3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DLG3

Antigène: DLG3 (Discs, Large Homolog 3 (DLG3))

Autre désignation: DLG3

Sujet: DLG3 is required for learning most likely through its role in synaptic plasticity following NMDA receptor signaling. Defects in DLG3 are the cause of mental retardation X-linked type 90 (MRX90).

Poids moléculaire: 58 kDa (MW of target protein)