IgA anticorps (Middle Region)

N° du produit ABIN635180

Détail du produit anti-IgA anticorps

Antigène: IgA

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IgA est non-conjugé

Application: Western Blotting (WB)

Specificité: PIGA antibody was raised against the middle region of PIGA

Purification: Affinity purified

Immunogène: PIGA antibody was raised using the middle region of PIGA corresponding to a region with amino acids SVKSLCEGLEKAIFQLKSGTLPAPENIHNIVKTFYTWRNVAERTEKVYDR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PIGA Blocking Peptide, catalog no. 33R-8916, is also available for use as a blocking control in assays to test for specificity of this PIGA antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIGA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IgA

Antigène: IgA

Abstract: IgA Produits

Synonymes: anticorps MB-1, anticorps IG-alpha, anticorps IGA, anticorps IgA, anticorps Igh-2, anticorps CD79a molecule, anticorps immunoglobulin heavy constant alpha, anticorps CD79A, anticorps Igha

Classe de substances: Antibody

Sujet: PIGA is a protein required for synthesis of N-acetylglucosaminyl phosphatidylinositol (GlcNAc-PI), the first intermediate in the biosynthetic pathway of GPI anchor. The GPI anchor is a glycolipid found on many blood cells and which serves to anchor proteins to the cell surface. Paroxysmal nocturnal hemoglobinuria, an acquired hematologic disorder, has been shown to result from mutations in this gene.

Poids moléculaire: 19 kDa (MW of target protein)