STRA6 anticorps

N° du produit ABIN635189

Détail du produit anti-STRA6 anticorps

Antigène: STRA6 (Stimulated By Retinoic Acid 6 (STRA6))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp STRA6 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: STRA6 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSSQPAGNQTSPGATEDYSYGSWYIDEPQGGEELQPEGEVPSCHTSIPPG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

STRA6 Blocking Peptide, catalog no. 33R-6506, is also available for use as a blocking control in assays to test for specificity of this STRA6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STRA6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur STRA6

Antigène: STRA6 (Stimulated By Retinoic Acid 6 (STRA6))

Autre désignation: STRA6 (STRA6 Produits)

Synonymes: anticorps MCOPCB8, anticorps MCOPS9, anticorps AI891933, anticorps RGD1307551, anticorps STRA6, anticorps im:7151282, anticorps wu:fc51h06, anticorps zgc:136689, anticorps mcops9, anticorps pp14296, anticorps stimulated by retinoic acid 6, anticorps stimulated by retinoic acid gene 6, anticorps stimulated by retinoic acid gene 6 homolog (mouse), anticorps STRA6, anticorps Stra6, anticorps stra6

Sujet: STRA6 may act as a high-affinity cell-surface receptor for the complex retinol-retinol binding protein (RBP/RBP4). STRA6 acts by removing retinol from RBP/RBP4 and transports it across the plasma membrane, where it can be metabolized. This mechanism does not depend on endocytosis. STRA6 binds to RBP/RBP4 with high affinity. STRA6 increases cellular retinol uptake from the retinol-RBP complex.

Poids moléculaire: 73 kDa (MW of target protein)

Pathways: Feeding Behaviour