DLG2 anticorps

N° du produit ABIN635193

Détail du produit anti-DLG2 anticorps

Antigène: DLG2 (Discs, Large Homolog 2 (DLG2))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DLG2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: DLG2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MFFACYCALRTNVKKYRYQDEDAPHDHSLPRLTHEVRGPELVHVSEKNLS

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DLG2 Blocking Peptide, catalog no. 33R-5991, is also available for use as a blocking control in assays to test for specificity of this DLG2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLG2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DLG2

Antigène: DLG2 (Discs, Large Homolog 2 (DLG2))

Autre désignation: DLG2 (DLG2 Produits)

Synonymes: anticorps PPP1R58, anticorps PSD-93, anticorps PSD93, anticorps chapsyn-110, anticorps A330103J02Rik, anticorps B230218P12Rik, anticorps B330007M19Rik, anticorps Dlgh2, anticorps Gm1197, anticorps discs, large homolog 2 (Drosophila), anticorps discs large MAGUK scaffold protein 2, anticorps dlg2, anticorps DLG2, anticorps Dlg2

Sujet: DLG2 is a member of the membrane-associated guanylate kinase (MAGUK) family. The protein forms a heterodimer with a related family member that may interact at postsynaptic sites to form a multimeric scaffold for the clustering of receptors, ion channels, and associated signaling proteins.

Poids moléculaire: 97 kDa (MW of target protein)