IL18R1 anticorps (N-Term)

N° du produit ABIN635200

Détail du produit anti-IL18R1 anticorps

Antigène: IL18R1 (Interleukin 18 Receptor 1 (IL18R1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IL18R1 est non-conjugé

Application: Western Blotting (WB)

Specificité: IL18 R1 antibody was raised against the N terminal of IL18 1

Purification: Affinity purified

Immunogène: IL18 R1 antibody was raised using the N terminal of IL18 1 corresponding to a region with amino acids PFYLKHCSCSLAHEIETTTKSWYKSSGSQEHVELNPRSSSRIALHDCVLE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IL18R1 Blocking Peptide, catalog no. 33R-7090, is also available for use as a blocking control in assays to test for specificity of this IL18R1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL10 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IL18R1

Antigène: IL18R1 (Interleukin 18 Receptor 1 (IL18R1))

Autre désignation: IL18R1 (IL18R1 Produits)

Synonymes: anticorps CD218a, anticorps CDw218a, anticorps IL-1Rrp, anticorps IL18RA, anticorps IL1RRP, anticorps IL-1R9, anticorps IL1R9, anticorps IL1RAPL-2, anticorps TIGIRR-1, anticorps Il18ralpha, anticorps Il1rrp, anticorps IL-18Ra, anticorps IL18R1, anticorps interleukin 18 receptor 1, anticorps interleukin 1 receptor accessory protein like 2, anticorps IL18R1, anticorps IL1RAPL2, anticorps Il18r1

Sujet: The protein encoded by this gene is a cytokine receptor that belongs to the interleukin 1 receptor family. This receptor specifically binds interleukin 18 (IL18), and is essential for IL18 mediated signal transduction.

Poids moléculaire: 60 kDa (MW of target protein)