SFXN3 anticorps (Middle Region)

N° du produit ABIN635208

Détail du produit anti-SFXN3 anticorps

Antigène: SFXN3 (Sideroflexin 3 (SFXN3))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SFXN3 est non-conjugé

Application: Western Blotting (WB)

Specificité: Sideroflexin 3 antibody was raised against the middle region of SFXN3

Purification: Affinity purified

Immunogène: Sideroflexin 3 antibody was raised using the middle region of SFXN3 corresponding to a region with amino acids TPITVRQLGTAYVSATTGAVATALGLKSLTKHLPPLVGRFVPFAAVAAAN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Sideroflexin 3 Blocking Peptide, catalog no. 33R-9223, is also available for use as a blocking control in assays to test for specificity of this Sideroflexin 3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFXN3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SFXN3

Antigène: SFXN3 (Sideroflexin 3 (SFXN3))

Autre désignation: Sideroflexin 3 (SFXN3 Produits)

Synonymes: anticorps xm278, anticorps BA108L7.2, anticorps SFX3, anticorps TCC, anticorps sideroflexin 3 L homeolog, anticorps sideroflexin 3, anticorps sfxn3.L, anticorps SFXN3, anticorps Sfxn3

Sujet: SFXN3 is a potential iron transporter.

Poids moléculaire: 36 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis