FMO5 anticorps (Middle Region)

N° du produit ABIN635212

Cet anticorps Lapin Polyclonal détecte spécifiquement FMO5 dans WB. Il présente une réactivité envers Humain et Souris.

Aperçu rapide pour FMO5 anticorps (Middle Region) (ABIN635212)

Antigène: FMO5 (Flavin Containing Monooxygenase 5 (FMO5))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FMO5 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-FMO5 anticorps

Épitope: Middle Region

Specificité: FMO5 antibody was raised against the middle region of FMO5

Purification: Affinity purified

Immunogène: FMO5 antibody was raised using the middle region of FMO5 corresponding to a region with amino acids NKYLEKKINQRFDHEMFGLKPKHRALSQHPTLNDDLPNRIISGLVKVKGN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FMO5 Blocking Peptide, (ABIN5613625), is also available for use as a blocking control in assays to test for specificity of this FMO5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FMO5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FMO5

Antigène: FMO5 (Flavin Containing Monooxygenase 5 (FMO5))

Autre désignation: FMO5

Sujet: Metabolic N-oxidation of the diet-derived amino-trimethylamine (TMA) is mediated by flavin-containing monooxygenase and is subject to an inherited FMO3 polymorphism in man resulting in a small subpopulation with reduced TMA N-oxidation capacity.

Poids moléculaire: 59 kDa (MW of target protein)